Recombinant Complement Component 1, Q Subcomponent A (C1qA)
Catalog No.：GXP87072
Specification ：100μg
Sequence Information
Catalog No.：GXP87072 100μg
Species：Human Gene ID:712
Swiss Prot:P02745 Synonyms:N/A Residues:Ala28~Ala245
APDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGA
RGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYY YFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGH IYQGSEADSVFSGFLIFPSA
Product Information
Source: Prokaryotic expression.
Host: E. coli
Tags: N-terminal His-Tag. Subcellular Location: Secreted. Purity: >90%
Traits: Freeze-dried powder
Buffer formulation: 20mM Tris, 150mM NaCl, pH8.0, 5% Trehalose.
Original Concentration: 200μg/mL
Applications: Positive Control; Immunogen; SDS-PAGE; WB.
(May be suitable for use in other assays to be determined by the end user.)
Predicted isoelectric point: 9.6
Predicted Molecular Mass: 26.8kDa
Accurate Molecular Mass: 30kDa as determined by SDS-PAGE reducing conditions.
[ USAGE ]
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
